Cytokeratin 7 anticorps (N-Term)

N° du produit ABIN631503

Cet anticorps anti-Cytokeratin 7 est un anticorps Lapin Polyclonal détectant Cytokeratin 7 dans WB. Adapté pour Humain.

Aperçu rapide pour Cytokeratin 7 anticorps (N-Term) (ABIN631503)

Antigène: Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytokeratin 7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cytokeratin 7 anticorps

Épitope: N-Term

Specificité: Cytokeratin 7 antibody was raised against the N terminal of KRT7

Purification: Affinity purified

Immunogène: Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 7 Blocking Peptide, (ABIN5613107), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytokeratin 7

Antigène: Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))

Autre désignation: Cytokeratin 7

Sujet: KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Poids moléculaire: 52 kDa (MW of target protein)